BACK HOME

Q6L8G9 Proteins with OtherRepeats Repeats

Uniprot ID: Q6L8G9	Protein name : Keratin-associated protein 5-6	Gene : KRTAP5-6 KAP5.6 KRTAP5.6
Protein Families : KRTAP type 5 family	Squence Length : 129

Sequence	>Q6L8G9 130 MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI
Repeat regions	REPEAT 28 31 1 REPEAT 34 37 2 REPEAT 40 43 3 REPEAT 90 93 4 REPEAT 109 112 5 REPEAT 119 122 6
Sequence region of repeats	28- 31 VPIC 34- 37 KPVC 40- 43 VPAC 90- 93 KPCY 109- 112 KPCC 119- 122 VPIC
Function	"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation